SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000192 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000192
Domain Number 1 Region: 49-340
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.37e-93
Family alpha-D-glucuronidase/Hyaluronidase catalytic domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 704-901
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000361
Family N-acetyl transferase, NAT 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000192   Gene: ENSCPOG00000000219   Transcript: ENSCPOT00000000222
Sequence length 903
Comment pep:known_by_projection scaffold:cavPor3:scaffold_11:12685634:12719987:1 gene:ENSCPOG00000000219 transcript:ENSCPOT00000000222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKEGKAALEERDADLNSSPVASAGAALEPQAGVWPGRRPSVGGARRFLCGVVEGFYGR
PWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLMTLISAAREYEI
EFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNMCAADKEVFSSF
AHAQVSITNEIYQYLGEPETFLFCPTDYWTFSPPKPMTIQYNNHVGDCLNMWWSLFLGPK
VVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTN
PNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLENEGSDEDIETDVL
YSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGAPLVAAPSLNSTTVVTTVY
QEPIMSQGAALSGEPTALTKEEEKKQSDEEPMDMVVEKQEETDHKNDNQILTEIVEAKMA
EELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPV
TLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAK
FEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLI
GDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPYFPKDEASVYKICR
EMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYALGTVDVTPFIKKC
KISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFPSLIKMDIHKKVTD
PSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIAKMEGFPKDVVILG
RSL
Download sequence
Identical sequences ENSCPOP00000000192 ENSCPOP00000000192 10141.ENSCPOP00000000192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]