SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000235 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000235
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Globin-like 3.66e-47
Family Globins 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000235   Gene: ENSCPOG00000000267   Transcript: ENSCPOT00000000270
Sequence length 142
Comment pep:known scaffold:cavPor3:scaffold_4:20169103:20169845:1 gene:ENSCPOG00000000267 transcript:ENSCPOT00000000270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSAADKNNVKTTWDKIGGHAAEYVAEGLTRMFTSFPTTKTYFHHIDVSPGSGDIKAHG
KKVADALTTAVGHLDDLPTALSTLSDVHAHKLRVDPVNFKFLNHCLLVTLAAHLGADFTP
SIHASLDKFFASVSTVLTSKYR
Download sequence
Identical sequences A0A1K0GGE2 P01947
ENSCPOP00000000235 XP_003478455.1.53824 10141.ENSCPOP00000000235 ENSCPOP00000000235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]