SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000250 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000250
Domain Number 1 Region: 241-478
Classification Level Classification E-value
Superfamily vWA-like 2.49e-30
Family Integrin A (or I) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000250   Gene: ENSCPOG00000000285   Transcript: ENSCPOT00000000288
Sequence length 912
Comment pep:known_by_projection scaffold:cavPor3:scaffold_0:55779614:55791649:-1 gene:ENSCPOG00000000285 transcript:ENSCPOT00000000288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETMDGAMGLQTLLCVYLVSLLTLQAMPVLGLATGRSKSSEKRQAVDTIVNGVFIRSLKVN
CKVTSRFAHYVITSQVENSADTAREVAFEVEIPKTAFISDFAITANRNTFIGDIKDKVTA
WKQYRKAAISGENAGLVRASGRNMEQFTIHITVGPQSKAIFRLTYEEVLKRKLTQYNIII
KVKPKQLVHHFEIDVDIFEPQGISKLDAQASFLTKELAAQTIKKSFSGKKGHVLFRPTVS
QQQSCPTCSTSLLNGDFTVTYDVNRNKLCDLLVANNYFAHFFAPQNLTNMRKNLVFVIDI
SGSMEGQKVKQTKEALLKILQDMRPEDYFDLVLFGSNVQSWKGSLVQASKANLQAAGDFV
RRFSLHGATNLNGGLLRGIEILNKAQERLPELNKHASIVIMLTDGEPTEGVTDRAQIQKN
IRNAIQGRFPLYNLGFGNDVDFTFLEVMSMENNGWAQRIYEDHDAAQQLQGFYNQVSSPL
LVDVDMQYPPDAVSALTQHRHKQYYDGSEIVVAGRIADNKLGVFKADVKAQGEGQEFRTT
CLVDEEEMKKLLQERGHLLENHVERLWAYLTIQQLLAKRMKAEGEEKANLSAQVLKMSLD
YQFVTPLTSMTIRGMEDEDGLEPTIDKSPEDSPPLEMVGPRRTFVLSALQPAPTQPSSSF
QQLPNRVTGVDTDPHFIIHVPQKEDTLCFNINEEPGVILSLVQDPDTGFSVNGQLIGSKA
RSPGKHEGTYFGRLGITNPATDFQLEVTPQNITLSPGSGGLMFSWRDQAVLRQDGMVVTI
NKKRNLVLSMDGKATFEVVLHRVWRGSAVHQDFLGFYVLDGRWMSPRTHGLLGQFLHPFD
FEVLDLRPGSDPTKPDATLVVKNRRLTVTRGLQKDYSKDPRHGAEVSCWFVHNNGAGLIH
GIHTDYIVPDIF
Download sequence
Identical sequences ENSCPOP00000000250 ENSCPOP00000000250 10141.ENSCPOP00000000250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]