SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000283 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000283
Domain Number 1 Region: 131-188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000278
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 2 Region: 193-254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000189
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 7-69
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000809
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 68-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000361
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000283   Gene: ENSCPOG00000000325   Transcript: ENSCPOT00000000328
Sequence length 447
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:635585:667049:1 gene:ENSCPOG00000000325 transcript:ENSCPOT00000000328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLDELHVCADPGVLEHGFWSPSGAVFFEGSVTRFHCQDGFKLKGSTKRLCVKQLNGTLAW
VPSDRPICVQEDCRIPQIEDAEVQNKTYRHGDKLIIACHEGFKIRYPDLHNVASLCQDDG
SWDNLPICQGCLRPLASSNGYLNVSESQSSPAGTVIAYRCFPGFKLEGAEHLECLHNLIW
SSSPPRCLALEAQVCPLPPMVSHGDFICHPRPCERYNHGTVVEFYCDPGYSLTSDYKYIT
CQYGEWFPSYQVYCIKSAEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKF
KAHFPPRGLPRSSSSDPDFVVVDGVPVLLPSYDEAVGGSTSALGPGFLAAMGPGCLMPGD
DQSPPAYPGDQEAGMRDSPETCDSASASSELLQSLYPPSPGQVRACHAPQDPTMAPDTRE
ATGTSEAASTSPGIDIADEIPLIEEGP
Download sequence
Identical sequences ENSCPOP00000000283 ENSCPOP00000000283 10141.ENSCPOP00000000283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]