SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000426 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000426
Domain Number 1 Region: 141-209
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000916
Family Snake venom toxins 0.042
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000426
Domain Number - Region: 42-115
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0364
Family Extracellular domain of cell surface receptors 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000426   Gene: ENSCPOG00000000483   Transcript: ENSCPOT00000000488
Sequence length 253
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:4558488:4560752:1 gene:ENSCPOG00000000483 transcript:ENSCPOT00000000488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMGHFQDLLLLFLLGSSFLTLAQHLLCQKSVSLTIEEDPSNSFNWTTEQVETCEQNALCQ
ETIIMITAAGGKTAILATKGCIYNVGESATFIQHSPPPGLVAVSYSNYCGDTLCNNRESI
ASFWKQEETTGTQGKAPAVPALSCPTCVALGFCVSAPSLPCPHGTTRCYHGKLNVSGGGI
DSSVEVKGCTVTAGCRLMARITMVGPILVKEVCSPQPGLQARKAASGATWFSSSVWRLDL
QLSLLLQSLGLLP
Download sequence
Identical sequences ENSCPOP00000000426 10141.ENSCPOP00000000426 ENSCPOP00000000426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]