SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000591 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000591
Domain Number 1 Region: 5-362
Classification Level Classification E-value
Superfamily TROVE domain-like 5.62e-134
Family TROVE domain-like 0.0000000000275
Further Details:      
 
Domain Number 2 Region: 364-532
Classification Level Classification E-value
Superfamily vWA-like 9.27e-41
Family RoRNP C-terminal domain-like 0.000000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000591   Gene: ENSCPOG00000000669   Transcript: ENSCPOT00000000674
Sequence length 535
Comment pep:known_by_projection scaffold:cavPor3:scaffold_12:28452340:28463590:-1 gene:ENSCPOG00000000669 transcript:ENSCPOT00000000674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESVNQMQPLNEKQIVNSEGGHVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEA
LIRLIEDGRGYEVIQEIKSFSQEGRTAKQEPLLFALAICSQCSDINTKQAAFKAVSEVCR
IPTHLFTFIQFKKDLKESMKCGMWGRALRKAVADWYNEKGGMALALAVTKYKQRNGWSHK
DLLRLSHLKPSNEGLAIVTKYITKGWKEVHELYKEKALPVETEKLLKYLEAVEKVKRTKD
ELEVIHLIEEHRLVREHLLTNHLKSKEVWRALLQEMPLTALLRNLGKMTANSVLEPGNSE
VSLVCEKLCNEKLLKKARIHPFHVLIALETYRIGHGLRGKLKWCPCEEILKALDAAFYKT
FKTVEPTGKRFLLAIDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV
PCPVTKDMTLQQVLMAMSQIPAGGTDCSLKVWAQKTNTAADVFIVFTDNETLQNVHLCAL
RDYRKKVDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDVI
Download sequence
Identical sequences ENSCPOP00000000591 ENSCPOP00000000591 10141.ENSCPOP00000000591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]