SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000604 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000604
Domain Number 1 Region: 615-891
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1e-108
Family PDEase 0.000000151
Further Details:      
 
Domain Number 2 Region: 199-398
Classification Level Classification E-value
Superfamily GAF domain-like 1.07e-46
Family GAF domain 0.0001
Further Details:      
 
Domain Number 3 Region: 382-584
Classification Level Classification E-value
Superfamily GAF domain-like 2.4e-31
Family GAF domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000604   Gene: ENSCPOG00000000682   Transcript: ENSCPOT00000000687
Sequence length 892
Comment pep:known_by_projection scaffold:cavPor3:scaffold_3:12473330:12817291:1 gene:ENSCPOG00000000682 transcript:ENSCPOT00000000687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSFGLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGAPGSRPAPAGTGG
MASGSGRGGSSVGGSTGADGSASSQPTPGGGDSGGIPLSPSWASGCRGDGSLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPQYPPPAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKSLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSGDAENRFKVSVVSKELQYCDWTTSNSIRYL
VVNPSGYFPTNVITASQTPWFPDGKADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLD
GKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDNQVLSYHATCSKAEVD
KFKAANIPLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLT
VRKNYRMVLYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNN
AFQAKSGSALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSIL
ATDLTLYFERRTEFFELVSKGEYDWNIKNHRDVFRSMLMTACDLGAVTKPWEISRQVAEL
VTSEFFEQGDRERAELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQVIV
Download sequence
Identical sequences ENSCPOP00000000604 ENSCPOP00000000604 10141.ENSCPOP00000000604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]