SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000646 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000646
Domain Number 1 Region: 912-981
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.49e-19
Family TB module/8-cys domain 0.00071
Further Details:      
 
Domain Number 2 Region: 2297-2369
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.8e-19
Family TB module/8-cys domain 0.00049
Further Details:      
 
Domain Number 3 Region: 1649-1720
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.24e-18
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 4 Region: 2015-2086
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.31e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 5 Region: 2093-2227
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.75e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 490-611
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.28e-18
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 7 Region: 674-812
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 1810-1942
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 9 Region: 2413-2543
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 139-224
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.27e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 11 Region: 807-891
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.36e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 12 Region: 287-340,404-423
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.89e-16
Family TB module/8-cys domain 0.0029
Further Details:      
 
Domain Number 13 Region: 1278-1413
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.3e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 14 Region: 988-1118
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 15 Region: 1489-1562
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000183
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 16 Region: 1154-1296
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 17 Region: 609-704
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000288
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 18 Region: 2540-2656
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000157
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 19 Region: 1568-1623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000279
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 20 Region: 2371-2420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000401
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 21 Region: 1976-2029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000129
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 22 Region: 180-296
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 23 Region: 1118-1166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000226
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 24 Region: 408-498
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 25 Region: 2253-2302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000818
Family EGF-type module 0.008
Further Details:      
 
Domain Number 26 Region: 1727-1781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 27 Region: 1447-1493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family EGF-type module 0.00076
Further Details:      
 
Domain Number 28 Region: 1937-1982
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000094
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 29 Region: 1770-1809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000578
Family EGF-type module 0.01
Further Details:      
 
Domain Number 30 Region: 2216-2258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000706
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000646
Domain Number - Region: 110-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00272
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 2748-2795
Classification Level Classification E-value
Superfamily Cadherin-like 0.0126
Family Cadherin 0.015
Further Details:      
 
Domain Number - Region: 1402-1445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0547
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 76-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000646   Gene: ENSCPOG00000000726   Transcript: ENSCPOT00000000731
Sequence length 2834
Comment pep:known_by_projection scaffold:cavPor3:scaffold_6:15316761:15540285:1 gene:ENSCPOG00000000726 transcript:ENSCPOT00000000731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMC
TCSSGQISPTCGAKSIQQCSVRCMNGGTCADDHCQCQKGYIGTFCGQPVCENGCQNGGRC
IGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHP
CEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQS
ETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGARCIDQRTGTCFSGL
VNGRCAQELPGRMTRTQCCCEPGRCWGIGSIPEACPVRGSDDKGLDTILLLVSGILSAPP
IMLKHIPERKETGKCAGVILMKIQMPPPKTKYTAELQKTNAILNQTIDICKHHANLCLNG
RCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRTP
TKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCL
NGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINNEGSFRCDCPPGL
AVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKN
SEKYKKQLNSMAFCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPD
ASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCV
NGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLHIQDNRCEVNINGATLKSECCA
TLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCEC
PEGLTLDGTGRVCLDIRMEQCFLKWDEDECVHPVPGKFRMDACCCAVGAAWGTECEECPK
PGTKEYETLCPRGPGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNS
GFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDEC
ERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGT
YQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNAEGSYECSCSEGYALLPDGRSCA
DIDECENNPEICDGGQCTNIPGEYRCLCYDGFMASMDMKTCLDVNECDLNSNICMFGECE
NTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGN
GIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACAEGFTGDGFTCSDVDECAENINLCEN
GQCLNVPGAYRCECEMGFTPAPDSRSCQDIDECSYQNICVFGTCNKFAWKCSHCICDDGY
ELDRTGGKLYRYIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCY
LKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFR
PNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHP
GVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKR
MCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICA
NGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDSLCQRNADCINSPGSYRCECAA
GFKLSPNGACVVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECE
RHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDVDECSSFFGQVCRNGRCFNEIGSFKC
LCNEGYELTPDGKNCIEDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSESCIDIN
ECDEDPNICLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKA
FNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLES
PGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECN
CNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPMGYALREDQKMCKDLDEC
AEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNII
GSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGW
GHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTSGQCINTMGSFRCFCKV
GYTTDISGTSCVDLDECSQSPKPCNFICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQT
KQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCE
CQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYIQHYQWNQCVDENEC
SNPGACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYGCSNTEGGYL
CGCPPGYYRVGQGHCVSGMGFNKGQYLSLDTEVDEENALSPEACYECKINGYSKKESRQK
RSVDDPEPAAVEQVSLESVDMDSPVNMKFNLSGLGSEEHILELMPAIEPLNNHVRYVISQ
GNDDGVFRIHQRNGLSYLHTAKRKPLPGTYTLEITSVPLYRKKELRKLEESKEDDYLVGE
LGEALRMRLQIQLY
Download sequence
Identical sequences 10141.ENSCPOP00000000646 ENSCPOP00000000646 ENSCPOP00000000646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]