SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000667 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000667
Domain Number 1 Region: 22-150
Classification Level Classification E-value
Superfamily Lysozyme-like 4.56e-45
Family C-type lysozyme 0.00000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000667   Gene: ENSCPOG00000000748   Transcript: ENSCPOT00000000753
Sequence length 151
Comment pep:novel scaffold:cavPor3:scaffold_9:29220088:29224656:1 gene:ENSCPOG00000000748 transcript:ENSCPOT00000000753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQSSCRLSFFWVLLLSGTIYGKVYERRDLAKTLKAAGMDGYQGINLANWMCLAKAESSYN
TRVTNYNPGDKSTDYGIFQINSHYWCNDGKTPNAVNGCHVSCKALMQDDISQSVVCAKNI
VLDPQAKYAMMGWRKHCQNKDVKPYTHDCGV
Download sequence
Identical sequences ENSCPOP00000000667 ENSCPOP00000000667 10141.ENSCPOP00000000667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]