SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000782 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000782
Domain Number 1 Region: 318-450
Classification Level Classification E-value
Superfamily vWA-like 0.00000000445
Family Integrin A (or I) domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000782   Gene: ENSCPOG00000000869   Transcript: ENSCPOT00000000875
Sequence length 862
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:41174803:41183915:1 gene:ENSCPOG00000000869 transcript:ENSCPOT00000000875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPVGVPLACPGPSVLVLLQLLLSPTSAFFPNIWSLLAAPGSVTHQDLTEEAALNVTLQL
FLEQPPPGRPPLCLQDFLGHTLLADDLFAAYFGPGAPSRRFRAALGEVSRANAAQDFLAT
SKNDPDLHFDAERLDQARERLAGALRETLVAAGAQDHTLARQRLGAALHALQDFYSHSNW
VELGKQQPHPHLLWPRRRELWTLAQVDDPTCSDCEEPSCPGNLLSSSLLTSGYFGTHPPK
PPGKCSHGGRFDLSSAQPPRGGINKDSMAPGFSPHHALHPQAAQLALLASIQALNLLRGR
LGDKGFSRLLDLTTASSLSFVLDTTGSMGEEINAAKIQARRIMEQRRGGPMEPASYVLVP
FHDPGFGPVFTTSDPHTFWQRLNEIQALGGGDEPEMCLSALELALLHTPPLSDIFVFTDA
SPKDAFLTNRIESLAQERRCRVTFLVTEDPSRVQGRTRREVLSPLRFEPYEAVALASGGE
VIFTKDQHIQDVAAIVGDSMSALVTLPLDPPTLVPGRPSVFSVDGLLRKLTVRVHGKVCG
FRIRSPAGVSQDHEEGMGALGHTRRFGQFWLVTMADPPETGIWEIQVTAEDTPRVRVQAQ
TSLDFLFHFGVPMEDGPHPGLYSLAQPVAGLPTQLLVEVIGLGSRGSPEEDPPHFSHAVL
RRLPEGTKLGQVPLAPKGPAERGLLSASLPPALLSAPGAFALELVGQGGGQSLHRAAPQP
CSVAPVLLELSGPPGSLTPGSKVALSLRVASFSGFQDVELRTSVRPSFPLISNLSRVHVG
PNEATWGRLWLEVPEAAAPDSVVLVTVAAVGEAGTAPSAHAYLRLVVLDPASQAQLNFPT
DSLSPLAPLLAPALLKNVLILE
Download sequence
Identical sequences 10141.ENSCPOP00000000782 ENSCPOP00000000782 ENSCPOP00000000782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]