SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000798 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000798
Domain Number 1 Region: 42-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.41e-33
Family Thioltransferase 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000798   Gene: ENSCPOG00000000887   Transcript: ENSCPOT00000000893
Sequence length 156
Comment pep:known_by_projection scaffold:cavPor3:scaffold_129:3179312:3187209:-1 gene:ENSCPOG00000000887 transcript:ENSCPOT00000000893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTLRRAAAALLRWGRGSGGVGLQGTGVRAAGSGAGGGQAEQLDALVKKDKVVVFLKGT
PEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPDLRQGIKDYSNWPTIPQVYLNGEFVGG
CDILLQMHQNGDLVEELKKLGIRSALLDEKQDQDSK
Download sequence
Identical sequences H0UUY8
ENSCPOP00000000798 XP_003462704.1.53824 ENSCPOP00000000798 10141.ENSCPOP00000000798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]