SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000869 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000869
Domain Number 1 Region: 98-164
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000962
Family Ovomucoid domain III-like 0.0002
Further Details:      
 
Domain Number 2 Region: 191-239
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000707
Family Ovomucoid domain III-like 0.0086
Further Details:      
 
Domain Number 3 Region: 261-316
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000222
Family Ovomucoid domain III-like 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000869
Domain Number - Region: 27-65
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000157
Family TB module/8-cys domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000869   Gene: ENSCPOG00000000969   Transcript: ENSCPOT00000000975
Sequence length 344
Comment pep:known_by_projection scaffold:cavPor3:scaffold_29:8466332:8471437:-1 gene:ENSCPOG00000000969 transcript:ENSCPOT00000000975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR
LTTSWTEEDVSDNTLFKWMIFSGGAPNCIPCRETCENVDCGPGKKCRMNKKNKPRCVCAP
DCSNITWRGPVCGLDGRTYRNECALLKARCREQPELEVQYQGRCKKTCRDVFCPGSSTCV
VDQTNNAYCVTCNRICPEPTSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCI
KANSCEDIQCSGGKKCLWDFKVGRGRCSLCDELCPDSHSDEPVCASDNATYASECAMKEA
ACSSGVLLEVKHSGSCNSISEDTEEEDDDEDQDYSFPISSILEW
Download sequence
Identical sequences H0UV49
ENSCPOP00000000869 ENSCPOP00000000869 XP_005003834.1.53824 10141.ENSCPOP00000000869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]