SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000879 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000879
Domain Number 1 Region: 1-310,414-454
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.73e-78
Family FAD-linked reductases, N-terminal domain 0.000000000142
Further Details:      
 
Domain Number 2 Region: 290-400
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.22e-35
Family L-aminoacid/polyamine oxidase 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000879   Gene: ENSCPOG00000000980   Transcript: ENSCPOT00000000986
Sequence length 520
Comment pep:known scaffold:cavPor3:scaffold_33:14439374:14595855:1 gene:ENSCPOG00000000980 transcript:ENSCPOT00000000986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSKCDVVVVGGGISGLAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQNVKYVDLGGAY
VGPTQNRILRLAKELGLETYRVNDVERQIHHVKGKSYPFRGPFPPVWNPISYLDHNNLWR
TMDDMGKEIPSDAPWKAPLAEEWDHMTMKELLNKICWTNSARQFGTLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQISERIMNLLGDRVKLQRPVVYIDQ
TGESVLVETLNHEIYEAKYVISAIPPALGMKIHFKPPLPMMKNQLVSRVPLGSVIKCIVY
YKEPFWRKMDFCGTMVIEGEEAPVLYTMDDTKPDGSYAAIIGFIAAHKARKLARLTKEER
LKKLCELYAKVLGSKEALKPVHYEDKNWCEEQYSGGCYTAYFPPGIMTQYGRFLRQPVGR
IFFAGTETATHWSGYMEGAVEAGERAAREVLNAIGKIPEDEIWQPEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTVVSAVALGFLAQKRGLLLRI
Download sequence
Identical sequences H0UV57
10141.ENSCPOP00000000879 ENSCPOP00000000879 ENSCPOP00000000879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]