SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001148 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001148
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 125-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000183
Family Spermadhesin, CUB domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001148   Gene: ENSCPOG00000001267   Transcript: ENSCPOT00000001283
Sequence length 172
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:45102198:45105469:-1 gene:ENSCPOG00000001267 transcript:ENSCPOT00000001283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGGSGRCSGRVEVLHQGVWGTVCDDLWDLNEAKVVCRQLGCGQAVSSPGEAHFGAGTGSI
FLDNLQCSGMERFLGQCAHLGWSEHNCGHHEDAGVICSGIHFLRQNFLPGLSTASQDHIT
GGSNSCGGVISSLSGSFSSPQYPENYPTDIQCIWEIHVDKKFRIELTIPILK
Download sequence
Identical sequences ENSCPOP00000001148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]