SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001151 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001151
Domain Number 1 Region: 36-215
Classification Level Classification E-value
Superfamily vWA-like 1.48e-38
Family Integrin A (or I) domain 0.0000000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001151   Gene: ENSCPOG00000001271   Transcript: ENSCPOT00000001287
Sequence length 487
Comment pep:known_by_projection scaffold:cavPor3:scaffold_5:4006603:4094883:-1 gene:ENSCPOG00000001271 transcript:ENSCPOT00000001287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVPGRAAARAGWSSSLWLLALSGPGELLHAQEQPSCRRAFDLYFVLDKSGSVAHNWIEIF
NFVQQLTERFVSPEMRLSFIVFSSQASIILPLTGDRGKIQKGLEDLKRVSPVGETYIHEG
LKLANEQIQKAGGSKTSSIIIALTDGKLDGLVPSYAEKEAKLSRSLGANVYCVGVLDFEQ
AQLERIADSKEQVFPVKGGFQALRGIINSILDQSCTEILELRPSSVCVGEEFQVVLSGRG
FMLGSRNGTALCTFTVNETYTKSVRPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSA
ISSSLIITATECSNGIAALIAILVLLLLVGIGLMWWFWPLCCKVVIKDPPPPPPPAPEEK
EEDPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVTLPEEEE
EPIRPRPPRAPPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDETVSSSCS
FTLYPCQ
Download sequence
Identical sequences ENSCPOP00000001151 10141.ENSCPOP00000001151 ENSCPOP00000001151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]