SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001153 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001153
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.53e-24
Family N-acetyl transferase, NAT 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001153   Gene: ENSCPOG00000001273   Transcript: ENSCPOT00000001289
Sequence length 203
Comment pep:known_by_projection scaffold:cavPor3:scaffold_76:400254:404352:1 gene:ENSCPOG00000001273 transcript:ENSCPOT00000001289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLNQNTMLLGKKVVLVPYTSEHVPRYHDWMKSEELQRLTASEPLTLEQEYAMQRSWRED
ADKCTFIVLDSEKWQAQLGPEESCMVGDVNLFLTDLEDPTLGEIEVMIAEPSCRGRGFGT
EAALLMMSYGVTKLGLTKFEAKIGQGNEPSIRMFQKLHFEQVALNSVFQEVTLRLAVSEP
VRQWLLAQTSHVEEKAYRDGSAE
Download sequence
Identical sequences ENSCPOP00000001153 ENSCPOP00000001153 10141.ENSCPOP00000001153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]