SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001159 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001159
Domain Number 1 Region: 79-146
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.76e-18
Family Skp1 dimerisation domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 3-60
Classification Level Classification E-value
Superfamily POZ domain 0.000000000746
Family BTB/POZ domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001159   Gene: ENSCPOG00000001280   Transcript: ENSCPOT00000001296
Sequence length 153
Comment pep:novel scaffold:cavPor3:scaffold_46:8599839:8600334:1 gene:ENSCPOG00000001280 transcript:ENSCPOT00000001296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCLQSSDGEIFEADVEFANLEKSRPLDDGDNDSVHLPYVNEAIFKKVIQWCTNRNNDPL
PPPKDAKNKEKLRDNILVWDQELLKVDQAMFFELFLATNYLDIKDSLDVTCKTVADMFKG
KTPKEIHKTFNIKKTAEEEKAQGCKESQWCEEK
Download sequence
Identical sequences ENSCPOP00000001159 ENSCPOP00000001159 10141.ENSCPOP00000001159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]