SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001228 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001228
Domain Number 1 Region: 42-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000124
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001228   Gene: ENSCPOG00000001354   Transcript: ENSCPOT00000001373
Sequence length 294
Comment pep:known_by_projection scaffold:cavPor3:scaffold_14:27606596:27639757:1 gene:ENSCPOG00000001354 transcript:ENSCPOT00000001373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMEETPPPPLGCNKPHLEKLTLGITRILESSPGVTEVTIIEKAPAERHMISSWEQKNDCM
MPEDMKNFYLMTNGFHMTWSVKLDEHIIPLGNMAINSISKLTELNQSSVYSLPSAPTLAD
LEDDTYEASEDQPEKPHFDSRSVIFELDSCNGNGKVCLVYKTGKPALAQDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSLFKPITYNTDLLTGETD
SFMNKLDPSKVFKTKNKTVIPKKKGPVQPAGGQKGPSAPPAPKPSSSSANPIRK
Download sequence
Identical sequences ENSCPOP00000001228 ENSCPOP00000001228 10141.ENSCPOP00000001228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]