SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001315 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001315
Domain Number 1 Region: 504-654
Classification Level Classification E-value
Superfamily EF-hand 4.13e-51
Family Osteonectin 0.00000215
Further Details:      
 
Domain Number 2 Region: 451-501
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000804
Family Ovomucoid domain III-like 0.00068
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000001315
Domain Number - Region: 422-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family Follistatin (FS) module N-terminal domain, FS-N 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001315   Gene: ENSCPOG00000001455   Transcript: ENSCPOT00000001474
Sequence length 655
Comment pep:known_by_projection scaffold:cavPor3:scaffold_33:1184042:1201827:1 gene:ENSCPOG00000001455 transcript:ENSCPOT00000001474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTVPFLLCLLGTAVAIPTNARFLPDHSKSTAEPLVMPDNKEIPIVSADAADNEKETTGS
KENHPNHKAEQSSTLRSEEGTHELSAEQDKTQSHELGLKEQDGDDELSVNLEYSTTEGNL
EPQEDTGEPQKKKLQEDTDFSASNVSSLVDSNQQENITKGEGYQEQPGNDSHLQLDKNST
QSQDLREEESQEQDANIPNGKEEEETEPGKADTPTDNPDKEKEFPEDNSNSKQEDNEQPD
DILEEANQPTQVSKMQEDELEQGSQEKEEDNSNVGLEEDSASNISEHTPDTERQSQEGKM
GLKAIGDHKDIDKKTVSEALLLDPTDVNHMTPRNHGADTDNDDSKHSAGDDYFVPSQDFT
EAEKAQSISYHLKYEEERDRAHKNENVDASEPADHQEDKNAQSSSNEEEASSEGHMRAHG
TDSCVNFQCKRGHVCKAEPQGTPHCVCQDPETCPPAKPLDQACGTDNQTYASSCHLFATK
CRLEGTKKGHQLQLDYFGACKSIPVCTDFEVAQFPLRMRDWLKNILMQLYEPNPKHAGYL
NEKQRTKVKKIYLDEKRLLAGDHPIELLLRDFKKNYHMYVYPVHWQFSELDRHPMDRVLT
HSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF
Download sequence
Identical sequences H0UW89
10141.ENSCPOP00000001315 XP_003469421.1.53824 ENSCPOP00000001315 ENSCPOP00000001315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]