SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001400 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001400
Domain Number 1 Region: 3185-3449
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-51
Family YWTD domain 0.00000255
Further Details:      
 
Domain Number 2 Region: 381-642
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-44
Family YWTD domain 0.00000949
Further Details:      
 
Domain Number 3 Region: 697-954
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-43
Family YWTD domain 0.0000144
Further Details:      
 
Domain Number 4 Region: 1423-1683
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-42
Family YWTD domain 0.00000781
Further Details:      
 
Domain Number 5 Region: 4042-4312
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-37
Family YWTD domain 0.0000279
Further Details:      
 
Domain Number 6 Region: 2375-2626
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-36
Family YWTD domain 0.00000883
Further Details:      
 
Domain Number 7 Region: 1732-1997
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-36
Family YWTD domain 0.00014
Further Details:      
 
Domain Number 8 Region: 2053-2319
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-35
Family YWTD domain 0.0000344
Further Details:      
 
Domain Number 9 Region: 277-370,635-690
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000104
Family Growth factor receptor domain 0.025
Further Details:      
 
Domain Number 10 Region: 1323-1415,1677-1725
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000118
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 11 Region: 2719-2761
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000851
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 12 Region: 1249-1291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 13 Region: 10-47
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 14 Region: 3130-3178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 15 Region: 3613-3652
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000681
Family LDL receptor-like module 0.00054
Further Details:      
 
Domain Number 16 Region: 2971-3013
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000105
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 1090-1128
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 18 Region: 1132-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 19 Region: 46-86
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 20 Region: 3739-3779
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 21 Region: 3496-3531
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 22 Region: 3056-3095
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 23 Region: 2887-2925
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.00054
Further Details:      
 
Domain Number 24 Region: 3704-3741
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 25 Region: 3783-3820
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 26 Region: 1050-1087
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 27 Region: 2684-2721
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 28 Region: 1006-1044
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 29 Region: 3571-3615
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 30 Region: 85-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 31 Region: 3013-3055
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 32 Region: 1691-1726,2006-2043,2628-2692
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000267
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 33 Region: 206-242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 34 Region: 2842-2883
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 35 Region: 1170-1208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 36 Region: 3912-3948
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 37 Region: 167-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 38 Region: 1214-1249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 39 Region: 3532-3574
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 40 Region: 3826-3862
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000106
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 41 Region: 3096-3142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 42 Region: 2798-2844
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 43 Region: 2929-2972
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 44 Region: 3868-3906
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000118
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 45 Region: 1295-1331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 46 Region: 2765-2803
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 47 Region: 255-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 48 Region: 132-165
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000995
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 49 Region: 3667-3700
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 50 Region: 3993-4026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000051
Family EGF-type module 0.01
Further Details:      
 
Domain Number 51 Region: 3955-3994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00002
Family EGF-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000001400
Domain Number - Region: 4367-4398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000327
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 2326-2370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000403
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 3454-3515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 4318-4397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0251
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001400   Gene: ENSCPOG00000001548   Transcript: ENSCPOT00000001568
Sequence length 4639
Comment pep:known_by_projection scaffold:cavPor3:scaffold_3:20009466:20156209:1 gene:ENSCPOG00000001548 transcript:ENSCPOT00000001568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLFFCLMGITGCNADQFRCGNGYCIPAHWRCDGTRDCIDDTDEAGCPPRSCSASLFQCH
DGECISRLWVCDNEEDCDDGSDEHNCPGRTCSSDQLTCSSGQCVPRAYRCDHVQDCQDGT
DERDCQIDYPVCEQLTCANGACYNTSQKCDSKMDCRDSSDEVNCTETCMHDEFQCGTGEC
VPRGYLCDHDQDCNDGSDEHNCKYETCSGNQFTCPGGQCIHQNWVCDGQDDCPDFGDEDG
CGKGVADVHWGSVESWSCPNSGQCISIYQVCDGVPDCPRGADENSTSNESHCGTSLCSVL
NCEFQCHKTPYGGSCFCPPGYVINQNDSRTCVAFDDCQIWGICDQKCENRMGHHRCGCEE
GYVLERERHCRANTSFNEASVIFSNGRDLVIGDIHGRSFQILVHSQNRGLALGVDFHYQE
HKVFWTSFMENKVFSVDLNSLRIQEILNVSIEAPENMAVDWVNNKLYIVETRIKRIDMMN
LDGSHRITLIAENLGHPRGIAVDPTIGYLFFSDWRSLSGEPKLERAFMDGSNRKDLVKTK
LGWPAGVTLDLMAKRVYWVDSRFDCIETVTYDGIQRKTVLHGGSLIPHPFGISLFEENVF
YTDWTKMAVMKANKFEDTHPQTYYQSTLRPYGVTVYHALRQPNVSNPCGDHNGGCEQVCV
LSHRTDNGGLGYRCKCSFGFELDADEHHCRVLKSFLLFSSELAVRGIPFTHSTQEDVILP
VTRSTSFYLGIDFDAHENAIFFSDTSQDIIYKQKIDGTGREILTANRVENVESLTFDWIS
KNLYWTDGSLKSVSVMKLADKSRRAIVQNLNNPRAIVVHPIAGYIFFSDWFRPAKIMRAW
ADGSHLVPIVNTTLGWPNGLAIDWEASRLYWVDAFFDKIEHSTFDGFDRRRLGHVEQMTH
PFGLTVFKDHVYFTDWRLGAIVQVRKLDGGDMRIIRSGITNVMHVKAYDANLQTGTNYCS
QPTHPNGDCSHFCFPVPNFQRVCGCYGMKLASNHMTCEGDPAHEPPTEQCGSFSFACNNG
KCVPSFFRCDGIDDCHDNSDEHQCGTSNNTCSPWAFTCVHGGECIPGHWRCDRHNDCVDG
SDEQNCPTRPPTTCPESSYACDNNRCIPRDWLCDTDNDCGDGSDEKNCNSSSTCRPNQFH
CPDHRCIDPTYVCDGDKDCADGSDEAGCIYNCTTYQFKCADGSRCINNRYRCDGVYDCSD
NSDEAGCPTRPPGMCHTDEFQCQGDGTCIPNTWECDGHPDCIHGSDEHHGCVPKTCLSSQ
FHCDNGNCIYKEWVCDGDNDCRDMSDEKDCPTQPFHCPSWQWQCPGYAICVNLSAVCDGV
FDCPNGTDESPLCNEDSCSHFNGGCTHQCIQGPFGVTCLCPSGYQLANDTKTCEDINECD
TPGFCSQLCYNLRGSFRCTCDSDYNLEDDGRTCKATASENLLLLVASQNKIIADNITSHV
HNIFSLVENGSYVIALDFDSVSNRIFWSDSVQGKTWSAFQNGTDWRIIHESGVSITEAIA
VDWIGRNLYWIDYALETIEVSKIDGSHRMVLISKNVTNPRGLALDPRINEHIMFWSDWGR
HPRIERASMDGTLRTVIIQEKIYWPCGLTIDLPNRLIYFMDAYLDYLDFCDYNGQHRRQV
IAGNLNVLHPYALTLFEESVFWTDRATRQVMEANKWHGANQSVVMYNVPRPLGIVAVHPA
KQPRSPNPCASVPCSHLCLLSSQGPRFYSCACPSGWNLSHDSMSCVRGDQPFLMTVRMHV
IFGISLDPEVKSNDAMVPIAGIQSGFDVEFDEVEQFIYWVENPGEIHRVKTDGTNRTVFA
PLSLLGSSMGLAFDWISRNMYYTTPASQSIEVLTLRGETRYRKTLITNDGTNLGVGFPVG
IAVDPARGKLYWSDQGTDSGIPAKIASANMDGTSSKILFTGNMDHLEIVTLDIKEQKLYW
AVTSRGVIERGNVDGTERMILVYHLSHPWGIAVHDSFLYYSDEQYEVIERVDKASGANKV
VMRDNVPNLRGLRVYHRRNVGESSNGCSNNVNTCQQICLPVPGGLFSCACATGFKLNPDH
QTCSPYKSFIVVSMLSAIRGFSLEVSDHSEAMVPVAGQGRNALHVDVDVASGFIYWCDFS
SSVTSYNAIRRIRPDGSSFTNIVTSGIGGNGIRGIAVDWVAGNLYFTNGFATETLIEVLR
INTTYRRVLLKVTVDMPRHIVVDPKNRYLFWADYGQKPKIERSFLDCTNRTILVSEGIVT
PRGLAVDHSSGYIYWVDDSLDIIARIHRNGGESEVVRYGSHYPTPFGITVFGNSIIWVDR
NLKKIFQASKEPDNTDAPTVIRDNIYWLRDVTIFDESVQPRLPAEVDNNPCLENNGGCSH
FCFALPALNTPKCGCAFGTLQSDAKSCAISTENFLVYTSESSLRSLHFDLEDHNPPFQAI
SVERPAIALDYDTVDNRLYFTQALDSGRGQISYISLYSRTHTPTVIVSDIGTSNGIAFDW
INRRIYYSDYVNETINSIAEDGSMRTVVARISKPRSIVLDPCHGYMYWSNWDTPAQIEKA
TLGGNFRVPIVNTSLVWPSGLTLDYDLNLLYWVDTSLQKIERISVTGMNREVIISSAFRS
FGLTLYGQYIYWTNFFTKKVYRANKYDGSGQIAMTTTLPVRPKDICVARKDQNQHCTNPC
DQINGGCSHICVPGPNGAECVCPHEGQWYLANDNKFCVVDTGARCEHSQFTCLNGHCIQE
AWICDQDNDCGDGSDELEIVCAFHTCPPTTFTCANGRCVRYSYRCDHYNDCGDNSDEQGC
LFRSCNDTTEFTCSNGRCIPLEYVCNGVNNCHDNSTSDERNCPERTCPSGYTKCPNTNIC
ISRLYLCDGDNDCGDMSDENPTYCSTHTCSSSEFQCVSPQRCIPRSWYCDEEADCSDGSD
EPSTCTHAERTCLSNEFKCDGGRCIPRDWICDGDNDCGDMSDEDERHHCEQHTCSSSEFH
CANSVPPGRQCIPRSWVCDGDADCADAFDEHQNCTRRSCSAGEFTCNNGLCILQSYRCDR
RNDCGDYSDERDCSYPTCREYQFTCQNGRCINKLFVCDHDNDCGDESDEQEHLCHALQPT
CPPHQFKCDNGHCIEMVKVCNHLDDCSDNSDEKGCGINECLDHSISGCDHNCTDTVTSFY
CSCRPGYKLMSDKKTCVDIDECKETPYVCSQKCENEIGSYICKCAPGYIREPDGKTCRQN
SDIEPYLIFSNRYYLRNLTVDGYSYSLILQGLGNAVALDFDRVEKRLYWIDVQRQVIERM
FLNQTHREIIMSHRLPASKGLAVDWVSRKLYWVDAQLDGIFVSDLQGQYRRMLAQHCMDA
NNTFCFDNPRGIVVHPQYGYVYWTDWGEHAYIARVGMDGANKSVIISTKLSWPNAITIDY
TNDFLYWADAHLGYIEYSDLEGHHRHTVYDGVLPHPYAITVFEDTIYWTDWNTRTVEKGN
KYNGSNRVVLVNTTHRPFDIHVYHPYRQPIVNNPCGTNNGGCSHLCLIKAGGNGFTCECP
DDFQTLRLSGRTLCLPMCSSTQFLCANNEKCIPIWWKCDGQKDCSDGSDEPALCPHRFCQ
LGQFQCRDGNCTSPQSLCNGQQNCHDGSDEDHALCENHRCEPYQWQCANKQCIPDSWQCD
SVNDCLDNSDEDRAHCASRTCRPGQFRCNNGRCIPQTWKCDVDNDCGDYSDEPIHECMSA
AHRCDNHTDFSCKTNYRCVPLWTVCNGVDDCRDNSDEQGCEARTCHPSGDFRCKNHKCIP
LRWKCDGEDDCGDSSDEENCAPRECTESEFRCTNQQCIPSRWVCDQENDCGDNSDERDCE
LRTCHPEHFQCTSGHCIPSGFQCDGRADCLDASDESTCPTRFPNGTYCPAALFECKNHVC
VQSYFVCDGEDDCGDGSDEALHLCFSVACEPPQRFRCDNSRCLYAQRVCNGVDDCGDGTD
EKEEHCRKPTPKPCTENEFKCSNGNCISQLNICDDVDDCGDLSDETGCNIGKDRTCAENL
CEHNCTQLSEGGFICSCRSGYKAGTSDRNSCQDINECEGFGVCPQNCRNTKGSYECFCAD
GFRSLSTHYGERCAADGNPPLLLLPENVRIRKYNVSSEKFSEYLEDEEHIQTIDYDWDPE
GTGLSVVYYTVLAQSPRFGAIKRAYIPNFESGRNNPTHEVDLGLNYVMQPDGLAVDWVGR
HVYWSDAKNQRVEVARLDGRYRKWLVTTQLDQPTAIVVNPKLGLMFWSDQGKEPKIESAW
MNGEHRSVLVSENLGWPNGLSIDYLNNDRIYWSDSKEDVIETIKYDGSDRRVIVKEAMKP
YSLDIFEDKLYWVSKEKGEVWMQNKFGQGMKEKVLVVNPWLTQVRIFHQHRYNLSVSNPC
KDVCSHLCLLRPGGYSCACPQGSSFIKGSITECDAAIELPITMPPPCRCMYGGSCYFDEN
EYPKCKCVSGYTGAYCEIGLSQGIPPGTTAMAVLLTVLLIIILGALGAVGFFHYRKTGTL
LPALPKLPSLSSLVKPSENGNGVTFRSGVDVNMDIGVSDFGPESAIDRSMAMSEHFAMEM
GKEPVIFENPMYSARGTVVKVVLPAKVTVSENVENKNYGSPVNPSEIVPELKPTSPDVDG
TQATKWSIFKRKPKQTTNFENPIYAEMDNEQKEYVAAAPPPSPSPPAKTSQTRDPSLGYT
ATEDTFKDTANLVKEDSEA
Download sequence
Identical sequences 10141.ENSCPOP00000001400 ENSCPOP00000001400 ENSCPOP00000001400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]