SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001439 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001439
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.5e-29
Family N-acetyl transferase, NAT 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001439   Gene: ENSCPOG00000001593   Transcript: ENSCPOT00000001614
Sequence length 178
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:7218980:7230777:-1 gene:ENSCPOG00000001593 transcript:ENSCPOT00000001614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGK
AEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAV
NMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE
Download sequence
Identical sequences A0A096NVP9 A0A0D9RGA5 A0A1S2ZVZ1 A0A1U7QHX6 A0A1U7T3G0 A0A250YB44 A0A286XXE3 A0A2K5L8A4 A0A2K5QY99 A0A2K6EXT9 A0A2K6LWM5 A0A2K6Q9T3 A0A2K6S165 G3QNP5 G5CBB8 G7N327 G7PH27 H2P152 H2QK14 I3L8T8 I3MNG4 L8IXA8 M3XQ68 P61599 P61600 Q2PFM2
ENSPANP00000017124 NP_001135437.1.92730 NP_001193758.1.59421 NP_001193758.1.76553 NP_001270877.1.63531 NP_057184.1.87134 NP_057184.1.92137 XP_002710991.1.1745 XP_002830050.1.23681 XP_002919667.1.58354 XP_003411792.1.64505 XP_003476528.1.53824 XP_003810671.1.60992 XP_003933208.1.74449 XP_004014347.1.66739 XP_004061919.1.27298 XP_004270464.1.21590 XP_004376485.1.4749 XP_004413009.1.74151 XP_004413010.1.74151 XP_004447807.1.11602 XP_004585700.1.84141 XP_004614467.1.94378 XP_004635648.1.9945 XP_004687197.1.23501 XP_004754188.1.14098 XP_004840953.1.39548 XP_005072628.1.91757 XP_005320485.1.77405 XP_005365552.1.66349 XP_005381001.1.28644 XP_005889075.1.15283 XP_006062884.1.26621 XP_006097585.1.53796 XP_006235217.1.100692 XP_006737691.1.47382 XP_006860708.1.41390 XP_006895709.1.29581 XP_006921613.1.64745 XP_006984538.1.50099 XP_007191952.1.59432 XP_007454588.1.90284 XP_007525456.1.11023 XP_007618092.1.28591 XP_007648477.1.69978 XP_007946390.1.48129 XP_007959542.1.81039 XP_008050898.1.4292 XP_008139351.1.99482 XP_008586473.1.73410 XP_008839549.1.79516 XP_010367421.1.97406 XP_010632489.1.5607 XP_010834634.1.44457 XP_011279287.1.62641 XP_011369085.1.92234 XP_011818467.1.43180 XP_011834916.1.47321 XP_012015085.1.54773 XP_012318871.1.9421 XP_012512672.1.63892 XP_012612819.1.48125 XP_014437670.1.99106 XP_014711276.1.49734 XP_014926591.1.86478 XP_015005064.1.72884 XP_015338870.1.40921 XP_016001663.1.101085 XP_017397002.1.71028 XP_017738779.1.44346 XP_017912745.1.57651 XP_019317941.1.44245 XP_019508664.1.44202 XP_019783105.1.83887 XP_020026201.1.5219 XP_020734122.1.74333 XP_020842433.1.61212 XP_020933077.1.46622 XP_021049269.1.100879 XP_021556353.1.83697 XP_514540.2.37143 ENSTSYP00000005981 ENSMUSP00000105627 HGL_H00000335636-2 ENSP00000311027 10141.ENSCPOP00000001439 9598.ENSPTRP00000022806 9600.ENSPPYP00000012011 9606.ENSP00000335636 9913.ENSBTAP00000001522 ENSTSYP00000005981 ENSPTRP00000022806 369516 399820 GO.34173 GO.35094 gi|7705823|ref|NP_057184.1| ENSMPUP00000001218 ENSDNOP00000022281 ENSCPOP00000001439 ENSGGOP00000004164 ENSPVAP00000005869 ENSPPYP00000012011 ENSP00000335636 ENSPTRP00000022806 ENSPVAP00000005869 ENSP00000335636 ENSMPUP00000001218 ENSGGOP00000004164 ENSPPYP00000012011 ENSCPOP00000001439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]