SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001626 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000001626
Domain Number - Region: 36-137
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000876
Family Tricorn protease domain 2 0.03
Further Details:      
 
Domain Number - Region: 555-610
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0602
Family Transglutaminase, two C-terminal domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001626   Gene: ENSCPOG00000001797   Transcript: ENSCPOT00000001818
Sequence length 883
Comment pep:known_by_projection scaffold:cavPor3:scaffold_76:6038096:6046458:-1 gene:ENSCPOG00000001797 transcript:ENSCPOT00000001818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSEPRVHYLAGFSCPLGGLTSGKPRVLCHEEEVFLSTGSEFVYVYDQEGGLLTAVYQF
PDQVWHLQLLALRRALYVLCARRGIYCLSLEPRRRWSSSQTSEDNKDSEASSPVITVDPE
ACVLPDTTLCAFTVHDDVLVALVQGPAQWKMQLFERPRPGEDCQPGGLVGEVELSTSTPP
AGPPGKATVPCFLPVLCCVSPPGSKVPLGHPQGCGGFMLEKALFGLLFGADATLLESPVI
LCGLPDGQLCCVVLKALVTSQSAPGDPKALVKILHHLEEPVVFMGALKTEPQAEAAVESV
LSCEDVYSDCLVALGHHGRTLAIKASWDKSGNLVPELREYCLPGPVLCAACSGGSRMYHS
TPSDLCVVDLALGGIPLNSEQPQPDGVPGGLPPLLCPASLSICSVLTLSVLPNTPAGDTE
LLALSTKGCLMTCRLELSSEMPGPTRMTTENTGQKIKELLSGIGDVSERVSFLKKAVDQR
NKALTSLNEAMNVSCALLSSREGPPPISCTTTTAWSRLQLQDVLMATCLLENHSDFSLDQ
GWTLCIQVLTSSSALDLDSAGSAVTYTIPVDRLGPGSQREVTLPLGPSESGVLDLPVTVS
CTLFYSLKEVVGGALTPSDPLEDPFLEEQPLDLLPEQEGICLPLSRQTVDMLQCLRFPSL
APLCARTPCPLGPAADLVDTFLETCRAPSSEVAGPAALRAKYLPPSTASIRVSTELLRAA
LEDTHSGVPLCSATLQWLLAENAAVDIVRAQALSSVQGVAPDGTDVHLIVREVAVTDLCL
AGPIQAVEIQVESSSLADMCRAHHAIVRRMQTMVMEQAARGSSPPDLRVQYLRQIHANHE
ALLREVQTLRDRLCTEDEAGSCATAQRLLQVYKQLRSPSLVLL
Download sequence
Identical sequences ENSCPOP00000001626 ENSCPOP00000001626 10141.ENSCPOP00000001626 XP_003464853.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]