SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001632 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001632
Domain Number 1 Region: 139-201
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000293
Family Extracellular domain of cell surface receptors 0.063
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000001632
Domain Number - Region: 55-116
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0161
Family Snake venom toxins 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001632   Gene: ENSCPOG00000001804   Transcript: ENSCPOT00000001825
Sequence length 246
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:4363422:4365017:1 gene:ENSCPOG00000001804 transcript:ENSCPOT00000001825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPQHLRPVQLLCLLWAITFLPRAGGLLCYEAVASLFRGVTFSNWRWLLLRSMVCKQREG
CEETLVYIETGTHKGVLGFKGCSSASSYSPQVSYLVSPPGVSIASYSHVCRTYLCNNLTT
LQPFVRLKATDSKSVVYSSHNCPSCVGEHSRECLPVFVVLESCPMNAFACYSATIKFQAG
SLNTTFLLMGCTNAYRSFLAKFHHIGSIRVTEELNIVEKSWLIGAGHSSLGSFWSVLLGF
LLIFKH
Download sequence
Identical sequences XP_003464598.1.53824 ENSCPOP00000001632 ENSCPOP00000001632 10141.ENSCPOP00000001632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]