SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001650 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001650
Domain Number 1 Region: 337-605
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.18e-115
Family N-acetyl transferase, NAT 0.000000016
Further Details:      
 
Domain Number 2 Region: 182-224
Classification Level Classification E-value
Superfamily CCHHC domain 0.0000000000000183
Family CCHHC domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001650   Gene: ENSCPOG00000001822   Transcript: ENSCPOT00000001843
Sequence length 611
Comment pep:known_by_projection scaffold:cavPor3:scaffold_53:7879080:7906361:-1 gene:ENSCPOG00000001822 transcript:ENSCPOT00000001843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPNPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESMAKDVSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHSTRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
Download sequence
Identical sequences A0A286XQ03
XP_003466923.1.53824 10141.ENSCPOP00000001650 ENSCPOP00000001650 ENSCPOP00000001650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]