SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001710 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001710
Domain Number 1 Region: 93-213
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000917
Family N-acetyl transferase, NAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001710   Gene: ENSCPOG00000001891   Transcript: ENSCPOT00000001912
Sequence length 263
Comment pep:known_by_projection scaffold:cavPor3:scaffold_42:4969206:4982228:1 gene:ENSCPOG00000001891 transcript:ENSCPOT00000001912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRGCCSCYRLPAGKCVKEEPRVASGAMGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANR
LGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFDLTKTNMQSMYEQSEWGWKD
REKREEMTDDRAWYLIAWESSSVPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKF
LIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCSYEIL
SRKTKFGDSQHTHMGGHCGSCCH
Download sequence
Identical sequences ENSCPOP00000001710 ENSCPOP00000001710 10141.ENSCPOP00000001710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]