SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001768 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001768
Domain Number 1 Region: 56-182
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.99e-41
Family Ornithine decarboxylase antizyme-like 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001768   Gene: ENSCPOG00000001960   Transcript: ENSCPOT00000001982
Sequence length 189
Comment pep:known_by_projection scaffold:cavPor3:scaffold_0:81557502:81569165:1 gene:ENSCPOG00000001960 transcript:ENSCPOT00000001982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINTQDSSILPLSNCPQLQCCRHIVPGPLWCSDAPHPLSKIPGGRGGGRDPSLSALIYKD
EKLTVTQDLPVNDGKPHVVHFQYEVTEVKVSSWDAVLSSQSLFVEIPDGLLADGSKEGLL
ALLEFAEEKMKVNYVFICFRKGREDRAPLLRTFSFLGFEIVRPGHPCIPSRPDVMFMVYP
LDQNLSDED
Download sequence
Identical sequences H0UXF1
10141.ENSCPOP00000001768 NP_001276886.1.53824 ENSCPOP00000001768 ENSCPOP00000001768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]