SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001771 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001771
Domain Number 1 Region: 373-807
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.05e-44
Family Integrin alpha N-terminal domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000001771
Domain Number - Region: 25-181
Classification Level Classification E-value
Superfamily Phospholipase C/P1 nuclease 0.00168
Family Phospholipase C 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001771   Gene: ENSCPOG00000001963   Transcript: ENSCPOT00000001985
Sequence length 840
Comment pep:known_by_projection scaffold:cavPor3:scaffold_38:18776647:18825598:-1 gene:ENSCPOG00000001963 transcript:ENSCPOT00000001985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALWLWSGLLLLLAFLCPPSSSCGLSTHIEIGHRALEFLQLPRGHVNYEELLKEHQDAY
QAGSVFPDAFYPSFCKKSKGKFHDVSESTHWTPFLNASIHYIRENFPLPWEKNTEKLVAF
LFGITSHMVADVSWHSLDIEQGFLRTMAAIDFHGSYPDAHSAGDFGGDVVSQFEFNLNYL
ARRWYVPVKDLVGIYEKLYGQKVITENVIVDCSYLQFLEMYGEMLAVSKLYSTYSTKSPF
LVEHFQEYFLGGLDDMAFWSTNIYRLTSFMLENGTSNCDLPKNPLFIACGGQRNNSHSSK
VQKNGFYRNLTASVIKHTGKNINYTERGVFYHVDSWTPDSVTFVYQNLERNLRTMLMGSS
ENSLKHISRPSGSYYVSLPYARLGWAMASADLNQDGHGDLVVGAPGYSRPGHFQVGRVYL
IYGSDQGLPPIDLDLDKEAHRVLEGTQPSGRFGSAVAVLDFNKDGAPDLAVGAPSVGSEQ
LTYKGAVYIYFGSKGGRLSSFPDITVSCQDVYCNLGWTLLAADVSGDSEPDLLIGSPFAP
GGGKQKGMVAAFYSGSHRSNKGELSVEVADWLVRGKEDFAWFGYSMHGVTVNGSTLLLVG
SPTWQNVSRLGHSLHRHKDTQSLGKVYGYFPPSSQSGFVISGDKAMGKLGSSLSSGHVMM
NGTLTQVLLVGAPTRDDRSKMAFLTMTLHQGGNTRVYQLLPDVPPALLSTFSGDRRFSRF
GGVLHLSDLDNDGVDEIITAAPLRITDVTSGLLGGEDGRVYIYNGQHISLGDMTGKCKSW
ITPCPEEKAQYVLISPEASSRFGSSLISVRSKEKNQVVVAAGRSSLGARLSGALHVYSLS
Download sequence
Identical sequences 10141.ENSCPOP00000001771 ENSCPOP00000001771 ENSCPOP00000001771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]