SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001845 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001845
Domain Number 1 Region: 58-138
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000245
Family Extracellular domain of cell surface receptors 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001845   Gene: ENSCPOG00000002039   Transcript: ENSCPOT00000002066
Sequence length 167
Comment pep:known_by_projection scaffold:cavPor3:scaffold_95:2379881:2381261:1 gene:ENSCPOG00000002039 transcript:ENSCPOT00000002066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALGAMVLILLLCGQPGSSQAQEEEEEGDRDSDSYSYDDEEDEEEETNMIPGSRDRGTA
LSCYTCPLLHHGDSCNQTERCSSSQDSCVMLVSHSNTDSGPLTTYSMWCKDSCQPITKTV
KGTQMTKTCCHSPMCNAPPWQHPQIQDPLNGTTSSPQDSRTSHPQAG
Download sequence
Identical sequences ENSCPOP00000001845 ENSCPOP00000001845 10141.ENSCPOP00000001845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]