SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001848 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001848
Domain Number 1 Region: 44-133
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000139
Family Snake venom toxins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001848   Gene: ENSCPOG00000002042   Transcript: ENSCPOT00000002069
Sequence length 162
Comment pep:known_by_projection scaffold:cavPor3:scaffold_95:2346125:2347326:-1 gene:ENSCPOG00000002042 transcript:ENSCPOT00000002069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPAPQRTPVHSVCAYPRLAGSMLPSAMRGVGLVILTLLLCPTPAHGLWCQDCTLTTNSSH
CNPKLCSSSDTVCASVRITDPSSSRKDHSVNKMCASSCDFIKRHFFSDYLMGFINSGILK
VDVECCEKDLCNGVAAEVGHSAWALAVGLLLSLASALPWAEP
Download sequence
Identical sequences 10141.ENSCPOP00000001848 ENSCPOP00000001848 ENSCPOP00000001848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]