SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001989 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001989
Domain Number 1 Region: 28-396
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.18e-123
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000473
Further Details:      
 
Domain Number 2 Region: 495-639
Classification Level Classification E-value
Superfamily vWA-like 9.46e-29
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001989   Gene: ENSCPOG00000002193   Transcript: ENSCPOT00000002222
Sequence length 862
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:12247548:12288365:1 gene:ENSCPOG00000002193 transcript:ENSCPOT00000002222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASETPYATGMTIKKIGHRSVDPSVATTSSALKGAIQLGITHTVGSLSTKPERDVLMQDF
YVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIEL
CNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQ
AGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDMPDG
LFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLNNETQYTVDTRRP
TSQKALYSTAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYVGIIDILQSYRFVK
KLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRA
GSSGNSCITYQPSVSGEHRAQVTTKAEVEPEVHLGRPDVLPQTLPVEEVREDLLVSDPSF
SHVVGETLQVLNTSVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLA
NDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGS
PVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPP
GPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEA
RRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFSRTGLPDLSSMTEEEQIAYAMQMSL
QGAEFGQAESADMDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA
MGSLASQASKDGKKDKKEEDKK
Download sequence
Identical sequences ENSCPOP00000001989 10141.ENSCPOP00000001989 ENSCPOP00000001989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]