SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002022 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002022
Domain Number 1 Region: 1-30,79-200
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.87e-24
Family N-acetyl transferase, NAT 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000002022
Domain Number - Region: 18-85
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0131
Family ABC transporter transmembrane region 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002022   Gene: ENSCPOG00000002231   Transcript: ENSCPOT00000002260
Sequence length 227
Comment pep:novel scaffold:cavPor3:scaffold_37:15516395:15517078:1 gene:ENSCPOG00000002231 transcript:ENSCPOT00000002260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYEIRKYQENDRKTVLDLFSSGLLEHIPATFRYTLILPQTLLFIFGVLLSVFLASGSW
LLVIVSSLILLVFLWFLAGYTWKKRVNECLSTDLADITKSYLSECGSCFWVAESGGKVVG
IVCALLAEKQPLGKKRLRLRHLSVSWERRREGIGKALVRTVLQFAREQGCSEIVLSTSML
QYDALGLYQSMGFQKTGHSFYTRFSRLRGTPLFHLTYQFPSARDGGL
Download sequence
Identical sequences H0UY22
ENSCPOP00000002022 ENSCPOP00000002022 XP_013007027.1.53824 XP_013007028.1.53824 XP_013007029.1.53824 10141.ENSCPOP00000002022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]