SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002046 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002046
Domain Number 1 Region: 907-1082
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.63e-75
Family Transhydrogenase domain III (dIII) 0.0000000258
Further Details:      
 
Domain Number 2 Region: 58-230
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 3.06e-50
Family L-alanine dehydrogenase-like 0.00015
Further Details:      
 
Domain Number 3 Region: 199-378
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.1e-39
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000174
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000002046
Domain Number - Region: 229-261,380-473,500-562
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0971
Family FAD/NAD-linked reductases, N-terminal and central domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002046   Gene: ENSCPOG00000002255   Transcript: ENSCPOT00000002287
Sequence length 1086
Comment pep:known_by_projection scaffold:cavPor3:scaffold_29:13436911:13515990:-1 gene:ENSCPOG00000002255 transcript:ENSCPOT00000002287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANLLKTVVTGCSCPLLSNLGSCKVLPPKKDFLRTFHTHQSLWCKAPAKPGIPYKQLTVG
VPKEIFQNEKRVALSPAGVQALVKQGFNVIVESGAGEASKFSDDHYRAAGAQIQGTKEAL
ASDLVVKVRAPMVNPTSGVHEADLLKTSGTLISFIYPAQNPDLLNKLSKRKTTVLAMDQV
PRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGL
ASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAE
MKLFAQQCKEVDILISTALIPGKKAPVLFSKEMIESMKEGSVVVDLAAEAGGNFETTKPG
ELYIHKGVTHIGYTDLPSRMATQASTLYSNNITKLLKAISPDKDNFYFEVKDDFDFGTMG
HVIRGTTVMKDGEVIFPAPTPKNIPEGAPVKQKTVAEIEAEKAATVTPFSKTMTTASAYT
AGLTGILGLGVAAPDVAFSQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAV
GGMALMGGHLYPTTTSQGLAALATFISSVNIAGGFLVTQRMLDMFKRPTDPPEYNYLYLI
PAGTFIGGYLAALYSGYNIEQIMYLGSGLCCVGALAGLSTQGTARLGNALGMIGVAGGLA
ATLGGLKPSPELLAQMSGAMAMGGTIGLTIAKRIQISDLPQLVAAFHSLVGLAAVLTCIA
EYIVEYPHFAMDATANLTKIVAYLGTYIGGVTFSGSLVAYGKLQGILNSAPLLLPGRHAL
NAGLLAASVGGIIPFMIDPSFTTGITCLGSVSALSAVMGVTLTAAIGGADMPVVITVLNS
YSGWALCAEGFLLNNNLLTIVGALIGSSGAILSYIMCVAMNRSLANVILGGYGTTSTAGG
KPMEVSGTHTEINLDNAIDMIREANSIIITPGYGLCAAKAQYPIADLVKMLTEQGKKVRF
GIHPVAGRMPGQLNVLLAEAGVPYDIVLEMDEINHDFPDTDLVLVIGANDTVNSAAQEDP
NSIIAGMPVLEVWKSKQVIVMKRSLGVGYAAVDNPIFYKPNTAMLLGDAKKTCDALQAKV
RESYQK
Download sequence
Identical sequences A0A286XYT8
XP_003470242.1.53824 XP_005003837.1.53824 ENSCPOP00000002046 10141.ENSCPOP00000002046 ENSCPOP00000002046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]