SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Cavia porcellus 76_3 > ENSCPOP00000002057

Domain assignment for ENSCPOP00000002057 from Cavia porcellus 76_3

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSCPOP00000002057
Domain Number 1	Region: 20-119
Classification Level	Classification	E-value
Superfamily	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	5.75e-28
Family	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	0.0023
Further Details:

Domain Number 2	Region: 109-187
Classification Level	Classification	E-value
Superfamily	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	0.000000000000798
Family	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	0.007
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSCPOP00000002057 Gene: ENSCPOG00000002266 Transcript: ENSCPOT00000002298
Sequence length	301
Comment	pep:known_by_projection scaffold:cavPor3:scaffold_90:2641638:2656195:-1 gene:ENSCPOG00000002266 transcript:ENSCPOT00000002298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSDLGSEELEEEGENSLGEYEGERNEAGERHGHGRARLPNGDVYEGQYEFGQRNGQGVYK FKNGARYTGQYLKNKKHGQGTFIYPDGSRYEGEWADDQRHGYGVYYYVNNDTYTGEWFAH QRHGQGTYLYAETGSKYVGTWVHGQQVGAAELIHLNHRYQGKFLNKHPVGPGKYVFDIGC EQHGEYKLTDVVFGTKWSEQDTLANIIPKWKATQITDLALWTPTLPEKQPSSVGPGPDET LGEEGVPEMEEEVQALSDGFEGELDLRPGEEDTDAWELSSEIDQASTVVEEEEARQAELQ D
Download sequence
Identical sequences	ENSCPOP00000002057 ENSCPOP00000002057 10141.ENSCPOP00000002057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]