SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002141 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002141
Domain Number 1 Region: 7-86
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-20
Family PDZ domain 0.00061
Further Details:      
 
Domain Number 2 Region: 366-430
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.43e-18
Family LIM domain 0.012
Further Details:      
 
Domain Number 3 Region: 307-370
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.22e-18
Family LIM domain 0.028
Further Details:      
 
Domain Number 4 Region: 277-305
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000701
Family LIM domain 0.0047
Further Details:      
 
Domain Number 5 Region: 426-451
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000036
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002141   Gene: ENSCPOG00000002356   Transcript: ENSCPOT00000002389
Sequence length 456
Comment pep:known_by_projection scaffold:cavPor3:scaffold_17:23207716:23221608:-1 gene:ENSCPOG00000002356 transcript:ENSCPOT00000002389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFKVMLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGS
LTHIEAQNKIRACGERLSLGLSRPQPVQSKPQKALAPAAEPPRYTFAPSASLNKTARPFG
APLPADSAPQQNGQPFRPLVPDASKQRLMEDTEDWRPRPGTGQSRSFRILAHLTGTEFMQ
DPDEEHLKKSSQVPRTEAPAPASATPQEPWPGPTTPSPTSRPPWAVDPAFAERYAPDKTS
TVLTRHSQPATPTPLQNRTSIVQAAAGGGAGGANNGKTPVCHQCHKVIRGRYLVALGHAY
HPEEFVCSQCGKILEEGGFFEEKGAVFCPPCYDVRYAPSCAKCKKTITGEIMHALKMTWH
VHCFTCTACKTPIRNRAFYMEDGVPYCERDYEKMFGTKCRGCDFKIDAGDRFLEALGFSW
HDTCFVCAICQINLEGKTFYSKKDKPLCKSHAFSHV
Download sequence
Identical sequences H0UYD2
10141.ENSCPOP00000002141 XP_003473297.1.53824 ENSCPOP00000002141 ENSCPOP00000002141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]