SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002205 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002205
Domain Number 1 Region: 60-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000239
Family Spermadhesin, CUB domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002205   Gene: ENSCPOG00000002422   Transcript: ENSCPOT00000002455
Sequence length 322
Comment pep:known_by_projection scaffold:cavPor3:scaffold_29:1050566:1061147:1 gene:ENSCPOG00000002422 transcript:ENSCPOT00000002455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPSHKLQCHFVLLVLAALRGDSRYLELQDAADYDPFLLFSASPKRDLAGEQQYRRGAAC
LDMLSLPGQFTFTAARPQLHCAAFFIGEAEELLSIRFDLVSIDCTRGDFLKVFDGWILKG
EKFPSSQDHPVPTTDRYTDFCESGFSPRSIRSSQNVAMILFRVHEPGNGFTVTIKTDPNL
FPCNVISQTPNGRFTLVIPRQHRNCSFSIIYPVSIKISDLTLGHVHGLQLKKPSAGCGGT
GDFVELLGGAGLDPSKMMPLADLCYPFHGPAQMKIGCDNSVVRMVSSGKHINRVTFEYHQ
LAPYELGNPTGNSIPESCSSGL
Download sequence
Identical sequences ENSCPOP00000002205 10141.ENSCPOP00000002205 ENSCPOP00000002205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]