SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002371 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002371
Domain Number 1 Region: 112-361
Classification Level Classification E-value
Superfamily Carbamate kinase-like 1.05e-22
Family N-acetyl-l-glutamate kinase 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000002371
Domain Number - Region: 365-455
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00053
Family N-acetyl transferase, NAT 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002371   Gene: ENSCPOG00000002610   Transcript: ENSCPOT00000002644
Sequence length 522
Comment pep:known_by_projection scaffold:cavPor3:scaffold_67:9545253:9548205:-1 gene:ENSCPOG00000002610 transcript:ENSCPOT00000002644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRGAAVPRLRGPRDARSLSGSARRGAAGAASPGRRLSTARARARTSREEAEAQAEHTSSR
PARPRPLPSPPPPPPPPPLPPPEAPAASPAGRSLVQRDIQAFLSQCGASPGEARQWLARF
QTCHPAGDRPFAVIEVDGVVLECARAVSSLAFALAFLQRMDMRPLVVLGLPAPTAPSAVC
PSGTPRRSVARSCSAVTLCRHARACLSRGSVLSAAEPAPQASYGGIVAVETDLLRWCLEA
GSIPILCPVGETAARRAVLLDSLEVAAALAKALQPTKTIFLNAQGGLRDARQQVLSNVNL
PADLDLMSSAKWASPRERRQVRLITDVLSRLPRHCSAVVTAASELLTELFSNKGSGTLFQ
NAERMLRVRSLDSLDQARLVTLVNASFGKTLRDDYLASLRPRLHSVYVSEGYNAAAILTV
EPVLGGTPYLDKFVVSASRQGQGSGEMLWECLRRDLQTLFWRSRVTNPINPWYFRHSDGS
FSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFCKPALDPRS
Download sequence
Identical sequences 10141.ENSCPOP00000002371 ENSCPOP00000002371 ENSCPOP00000002371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]