SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002486 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002486
Domain Number 1 Region: 228-374
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.02e-36
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 116-213
Classification Level Classification E-value
Superfamily LCCL domain 8.24e-24
Family LCCL domain 0.00092
Further Details:      
 
Domain Number 3 Region: 3-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-22
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002486   Gene: ENSCPOG00000002737   Transcript: ENSCPOT00000002772
Sequence length 549
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:72905894:72936830:1 gene:ENSCPOG00000002737 transcript:ENSCPOT00000002772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGCGHMVTSQDSGTMTSKNYPGTYPNHTICEKKITVPEGKKLILRLGDVDIESQTCASA
SLLFTSSVEQYGPYCGSVTVPRNLLLNTSEVTVHFESGSHISGRGFLLTYASSDHPDLLT
CLERGNHYLRTEFSKFCPPGCRDIAGDVFGNAVDGYRDTSLLCKAAIHAGVIADELGGRI
HVLQHRGLSRYKGGLANGVLSRDGSLSGKRLLFTSSDCGGALSSDPWVQFQASSSWQGVS
DTGQPALWSPGRARLQDQGPSWAAGDSSSHEQQQWLEIDLGEEKKITGIKTTGSTQPDFN
FYVKSFVVSFRSSSRWRTYNGIMGHGEKVFQGNTNCQDPVQNNFIPPLTARYVRVLPRAW
HQRAALKVELLGCHISKGDESTEWPGSSPDTGLSTEGEELPTGPNPTPKEEGPPAGAGLS
VTTVATLLVLLGVLLLAAVGAFAAFRRKKKAGNPYASPETRKTGCWKPFQHPLATHLSAE
FTISYDNDDEGTDIQKGDLLASALECYQTPLDALVTDSAARAGSTFRPMDAHEYALPLTR
ARPEYATPI
Download sequence
Identical sequences ENSCPOP00000002486 ENSCPOP00000002486 10141.ENSCPOP00000002486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]