SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002502 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002502
Domain Number 1 Region: 23-142,334-643
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.31e-67
Family Integrin alpha N-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 162-357
Classification Level Classification E-value
Superfamily vWA-like 1.43e-46
Family Integrin A (or I) domain 0.00000382
Further Details:      
 
Domain Number 3 Region: 644-791
Classification Level Classification E-value
Superfamily Integrin domains 1.26e-24
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 4 Region: 792-930
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-23
Family Integrin domains 0.0058
Further Details:      
 
Domain Number 5 Region: 965-1124
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000012
Family Integrin domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002502   Gene: ENSCPOG00000002756   Transcript: ENSCPOT00000002791
Sequence length 1168
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:46283839:46298994:-1 gene:ENSCPOG00000002756 transcript:ENSCPOT00000002791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPLLPHLFLPLVCLTGLCSPFNLDAHHPRLFTGPPEAEFGYSVLQHVVGGRRWMLVGA
PWDGPSGDRRGDVYRCPVDGPHSVPCAKSHLGDYQLGNSSHPSVNMHLGMSLLQTDADGG
FLACAPLWSRACGSSVFTSGICARVDASFQPQESLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGRLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAARNLSRQEG
RETKTAQAILVACTEGFSQSRGGRPEAARLLVVVTDGESHDGEDLPAALKACEAGKVTRY
GIAVLGHYLRRHRDPSSFLREIREIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
HGENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEEGHHLFPQRTALEDEF
PPALQNHAAYLGYSVSSMLLPRGRRLFLSGAPRFRHRGKVIAFQFKKDGTVRVAHSLQGE
QIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYRVGQQSLLMLQGTLQ
PEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVMPHPAQRIA
AVSMPQSLSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSQPIVHVAPSLDITPPAIS
VVQRDCRRRRQEAVCLTAALCFHVTSRTPGHWDRQFNMWVTASLDEWTAGVRAAFDGSGQ
RLPPMRLQLSVGNVTCEQLYFYVLDTSDYLRPVVLTVAFTLDNTTKPGPVLDEGSPTFLQ
KLVPFSKDCGPDNECVTDLVLQAKMDIRGSRKAPFVVQGGRQKVLVSATLENRKENAYNT
SLSLTFSKNLHLASLIPQRDSPIKVECAAPIPHARLCSVGHPVFQTGAKVTFLLEFEFSC
TSLLRQVFMRLTASSSSLERNRTLQDNTAQISAYIRYEPHLLFSSESTLHRYEVHPYRIL
SLGPGPEFKTTLRVQNLGCYVVHGLVVSALLPAVAHGGSYFLSVSQVITNNASCKVQNLT
VPPLLPVHPEELQHTDRLNGSNTQCQVVRCHLGTLAKGAEVSIGLLRVVHNEFFRRAKFK
SLTVVSTFELGTEENSVLQLTEATRWSESLLEVIQTHPIPISLWILIGSILGGLLLLALL
VFCLWKLGFFTRKKIPEEEKRENKALER
Download sequence
Identical sequences ENSCPOP00000002502 ENSCPOP00000002502 10141.ENSCPOP00000002502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]