SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002811 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002811
Domain Number 1 Region: 388-613
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.24e-34
Family Calponin-homology domain, CH-domain 0.00044
Further Details:      
 
Domain Number 2 Region: 85-241,380-461
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.78e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.061
Further Details:      
 
Domain Number 3 Region: 723-752
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000271
Family LIM domain 0.00096
Further Details:      
 
Domain Number 4 Region: 691-722
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000539
Family LIM domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002811   Gene: ENSCPOG00000003105   Transcript: ENSCPOT00000003148
Sequence length 1058
Comment pep:known_by_projection scaffold:cavPor3:scaffold_63:8963885:8972540:-1 gene:ENSCPOG00000003105 transcript:ENSCPOT00000003148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSSPNPAHAHFESFLQAQLCQDVLSSFRELCGALGVEPGCGLPQYHKIKAQLNYWSA
KSLWAKLDKRASQPVYQQGQACTSTKCLVVGAGPCGLRAAVELALLGARVVLVEKRTKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGVT
FTGLQPPLRKGSGWRAQLQPKPPDQLANYEFDVLISAAGSKFVPEGFTVREMRGKLAIGI
TANFVNRRTAEETQVPEISGVARIYNQKFFQSLLKATGIDLENIVYYKDDTHYFVMTAKK
QCLLRLGVLRQDRLETEQLLSSANVVPEALQRFVRAAADFATNGKLGKLEFAQDARGRPD
ISAFDFTSMLRAECSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
KRWAEGTEPLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPASRYPNLNLKAVTPNQVR
DLYDVVAKGPVPKKNDKPNRGNPTTGSAGTQEELLHWCQEKTAGYPGVHVTDLSSSWADG
RALCALVHRLQPSLLGPSEVQDMGALEATTWALRAAEHELGITPVVSAQAVVAGSDPLGL
IAYLSHFHSAFKNTPNSPGPVNQGSPGTSSAVLFLGKLQRTLQRTRAKENSGDAGGKKPR
LEVEADTPRTEEPPAPESRGPLVPPPQQQEADARGLCALCGEHLYILERFCVDGHFFHRS
CFRCHACEATLWPGGYGQHPDGHFYCLQHLPGTDHKKDIMDGGSTSPELPTPDANSVPPG
PLTPTAPQEEASPIPCPRQPARRLIRLSSPERQRLSSLDINPSPEMEPPPKPPRSCSALA
REALEGSFVGWGMPARSLPVFEAMEEEESSSDNEEEEDDDEPLDPDLEQALQTMAKNAGT
MDKYPTWRRTLLRHAKEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKLELALRSQSTS
PEQQKKLWLEQLLQLVQKKNSLVAEEAELMITVQELDLEEKQWQLDHELRGYMNREETLK
TAEDRQAEDEILRKLVEVVNQRDALIRFREECRLSELA
Download sequence
Identical sequences ENSCPOP00000002811 ENSCPOP00000002811 10141.ENSCPOP00000002811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]