SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002968 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002968
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000192
Further Details:      
 
Domain Number 2 Region: 330-434
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.45e-22
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0028
Further Details:      
 
Domain Number 3 Region: 155-223,265-274
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.31e-21
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 4 Region: 321-331
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000575
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002968   Gene: ENSCPOG00000003284   Transcript: ENSCPOT00000003327
Sequence length 453
Comment pep:known_by_projection scaffold:cavPor3:scaffold_11:44745420:44772689:-1 gene:ENSCPOG00000003284 transcript:ENSCPOT00000003327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSSAVVQLYAADRNCLWSKKCSGVACLVKDNPQRSYFLRIYDIKDGKLLWEQELYNNFV
YNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLSRRQRKSEKRRDPPNGPNLPM
ATVDIKNPEITTNRFYGSQVNNISHITKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPEL
KNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQEPSPPQWSGMKIDNIPV
NLESICPPKHPARGRGAPPPPPSRAPTAAPPPPPSRPGASVPPPPPNRMHPPPPPALPSS
APSGPPPPPPPLSVTAGSVVPPPPPPPPPPPGPPPPPGLPSDGDHQVPMPAGNKAALLDQ
IREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALM
EVMQKRSKAIHSSEVQYLDARENDSLLDLEWES
Download sequence
Identical sequences 10141.ENSCPOP00000002968 ENSCPOP00000002968 ENSCPOP00000002968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]