SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003064 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003064
Domain Number 1 Region: 145-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.65e-81
Family Transglutaminase core 0.00000136
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 1.33e-40
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 472-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.22e-28
Family Transglutaminase, two C-terminal domains 0.002
Further Details:      
 
Domain Number 4 Region: 587-685
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.73e-23
Family Transglutaminase, two C-terminal domains 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003064   Gene: ENSCPOG00000003390   Transcript: ENSCPOT00000003433
Sequence length 691
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:28612227:28629609:-1 gene:ENSCPOG00000003390 transcript:ENSCPOT00000003433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STKGLGIKSCDLQAAKNNEEHHTRAISSQRLIVRRGKSFTITLHFQSPISAFLPALRKLA
LIAQTGQQPSKTNRTQAIFPITSLGDPKWWRAAVEKRDASFWTVAVTTPVDAVIGHYSLL
LQVSGQEQYHLGQFTLLFNPWNREDAVFLQNEAQCQEYVLDQNGLIFLGTADCIQEEPWD
FGQFESDVMDLSLDLLGVDKQVEEWSQPAHVARVLGALLHAIKEKKVLPTPKTPSAQEQV
LLNKRRGSAPILRQWLTGQGRPVYEGQAWVLAAVTCTVLRSLGIPARVVTTFASAQDTGG
SLLVNEYYNEEGLQNGEGQRGRIWIFHTSTECWMTRLDLCKGFDGWQILYPKVPSGGGVL
KACDLVPVKAVKEGALEVTPAVLDLFASVNASCVVWKCCEDGKLELTNFNTKYVGNNIST
KVVGSDRCEDITQNYKYPAGSLEEKAVLDRVQKERIRHKKHSSIHPPSCELDDPLYLFLE
APSFLPLGGDAKLSVTLKNPGDQEKAVQLVIGVQAVYYNGVLATDLWREKLSLRVSANKV
HQKNIILSSSSFEQNLPENSCLRLTVVATHSASSLSCFAQEDIAIRRPHLAITMPEVTQQ
YRPLRFEVSIHNSLDSAMKDCEMSIFGRGLIHREKRYRLSPVRPGKTLCSWFQFTPTQLG
LHRLTVEMDCDMFQNLTSHKSVTVVAPEFSA
Download sequence
Identical sequences 10141.ENSCPOP00000003064 ENSCPOP00000003064 ENSCPOP00000003064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]