SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003169 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003169
Domain Number 1 Region: 158-267
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.29e-21
Family Synaptotagmin-like (S variant) 0.035
Further Details:      
 
Domain Number 2 Region: 302-505
Classification Level Classification E-value
Superfamily vWA-like 5.68e-20
Family Integrin A (or I) domain 0.021
Further Details:      
 
Domain Number 3 Region: 19-136
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.21e-16
Family Synaptotagmin-like (S variant) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003169   Gene: ENSCPOG00000003506   Transcript: ENSCPOT00000003550
Sequence length 557
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:16755133:16759824:-1 gene:ENSCPOG00000003506 transcript:ENSCPOT00000003550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPEMGWVPEPPTMTLGASRVELRVSCHGLLDRDTLAKPHPCVLLKLYSEEQWVEVERT
EVLRSCSSPVFSRALALEYFFEEKQPLQFHVFDAEDGATSPSSDTFLGSTECTLGQIVSQ
TKVTKPLLLKNGKTAGKSTITIVAEEISGTNDYVQLTFRAQKLDNKDLFSKSDPFMEIYK
TNRDQSDQLVWRTEVVKNNLNPSWEPFRLSLHSLCSCDVHRPLKFLVYDYDSSGKHDFIG
EFTSTFQEMQEGTANPGQEMQWDCINPKYRDKKKNYKSSGSVVLAQCTVEKVHTFLDYIM
GGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQDYDSDKRFPAF
GFGARIPPNFEVSHDFAINFDPENPECEEISGVITSYRRCLPQIQLYGPTNVAPIINRVA
GPAQREQSTGQATKYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMR
LLDGDDGPLRCPQGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGIS
PGAPRPCTPGTTPSPSP
Download sequence
Identical sequences H0V113
ENSCPOP00000003169 10141.ENSCPOP00000003169 XP_013013223.1.53824 XP_013013224.1.53824 XP_013013225.1.53824 ENSCPOP00000003169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]