SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003208 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003208
Domain Number 1 Region: 13-127
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.81e-28
Family Ornithine decarboxylase antizyme-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003208   Gene: ENSCPOG00000003550   Transcript: ENSCPOT00000003594
Sequence length 138
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:12952077:12953727:1 gene:ENSCPOG00000003550 transcript:ENSCPOT00000003594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFFQAGNLTVLSPVPLLHQDPVQIDFHFHLTPNTSVHWHGLLCDHRLFLDIPYQALDQVS
RESLTATLEYVEEKTSVDSVFVNFQNNRKDKGDLLRAFSYMGFDVVRPDHPDLPPWDNAI
FMMYPLERDHGHLPSEPP
Download sequence
Identical sequences ENSCPOP00000003208 ENSCPOP00000003208 10141.ENSCPOP00000003208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]