SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003296 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003296
Domain Number 1 Region: 153-264
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-32
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 2 Region: 56-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-18
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003296   Gene: ENSCPOG00000003649   Transcript: ENSCPOT00000003693
Sequence length 609
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:45027211:45039665:1 gene:ENSCPOG00000003649 transcript:ENSCPOT00000003693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDQRRLIFLVLVIISCLVELNVSEAEGISSCTASLGGANLADTHSAVILQLNAAENCTW
TIERPEDKSVRIIFSHVQLDPEGTCESENIKVFDGHSTDGPLLGEVCSKNDFVPMFESSS
NTLTFQIITDSANIQRSVFIFYYYYSSDTIIPNCGGYLNTLEGSFTSPNYPRPHPELAYC
VWHIQVEKGYKIRLNFKEIFLEIDDYCRFDFIAVYDGSSTESGLMGQVCGRVTPTFDSSS
NALTVVLSTDYANSYRGFSASYTSIYAENIDTTSLICDSDKMRVIISKTYLESFNYNENN
LQLNDPTCRPEVSNVVEFTIPLDECGTIKKVEDHTISYTNVVSFVVSPMSAVITRQKHLE
IVVKCEMEYNSTVEIMYITEDDVIKNQNALGKYNTSMAFFESDSFENPILESPYYVDLNQ
TLFVQVSLHTSDPNLVVFLDACIASPTSDFGSPTYDLIKSGCSQDETCNVYPLFGHHGRF
QFNAFKFLRSLNSVYLQCKILICDSDDHESRCNEGCVSRRKRDISSYKWKTDSIIGPIRL
KRDRSASGNSGAGVLRQTPAEDTWSQPFNSLHVFSFVVLALNVVIVATITVRHFVKQRSD
YKYQRLQTI
Download sequence
Identical sequences ENSCPOP00000003296 10141.ENSCPOP00000003296 ENSCPOP00000003296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]