SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003298 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003298
Domain Number 1 Region: 116-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000473
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 263-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000118
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 78-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000181
Family Complement control module/SCR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003298   Gene: ENSCPOG00000003651   Transcript: ENSCPOT00000003695
Sequence length 465
Comment pep:known_by_projection scaffold:cavPor3:scaffold_26:3720449:3744896:-1 gene:ENSCPOG00000003651 transcript:ENSCPOT00000003695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQLTQRGALFLLLFLIPTVTPTWYAGSGYNPDESYNEVHTEDVPQAPPLYYQVPRWCY
TLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGQKSVQCLPSRRWSGTAYCRQI
RCHALPSITSGTYTCTNGVLLDSRCDYSCSRGYHLEGDRSRICMEDGRWSGGEPVCVDID
PPKIYCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSQFPEGEHVIR
YTAYDTAYNRASCKFIVKVQVRRCPILKPPQHGYLTCTSVGNNYGATCEYHCDGGYERQG
TPSRVCQSSRQWSGSPPICTPMKINVNVNSAAGLLDQFYEKRRLLIISAPDPSNRYYKMQ
ISMLQQSTCGLDLRHVTIIELVGQPPQDVGRIREQQLSSSIIEELRQFQHLTRFYFNMVL
IDKQGIDRERYMEPVTPEEIFTFIDDYLLSNQEMIQRQEQRDICE
Download sequence
Identical sequences H0V1D6
XP_003471003.1.53824 XP_013009159.1.53824 XP_013009160.1.53824 ENSCPOP00000003298 ENSCPOP00000003298 10141.ENSCPOP00000003298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]