SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003314 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003314
Domain Number 1 Region: 272-433
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.7e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000214
Further Details:      
 
Domain Number 2 Region: 112-270
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.45e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000959
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 67-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003314   Gene: ENSCPOG00000003673   Transcript: ENSCPOT00000003717
Sequence length 433
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:34993204:35003054:1 gene:ENSCPOG00000003673 transcript:ENSCPOT00000003717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGPRVLAALCGALLCASGLLAASGDFCDSSICLNGGTCLFGQDSVSSYCLCPEGFTGLL
CNETEKGPCSPNPCYHNAGCQVIDSSHRGDVFTPYICDCPPGYAGIHCETTCNRGLGMEE
GIIVDSQISASSLYIGFLGLQRWGPELARLHRSGIVNAWTASNYDRKPWIQVNLLRKMRV
TGVVTQGASRAGSAEYVKTFKVAYSLDGRKFQFIQNEEDSGDKVFTGNMNNNGLKLNMFS
APLEVQYVRLYPVACYRGCTLRFELLGCELNAGCSEPLGLKDGSIPNRQITASSSYKTWG
LPMFNWLPFLGRLDNRGKINAWTAQSNSPNASEWLQVDLGSKKQVTGIITQGARDFGHIQ
YVASYKVAYSDNGISWTEYKEPGAVDSKIFRGNLDNNSHKKNVFETPFSARYVRVLPVSW
QNRITLRLELLGC
Download sequence
Identical sequences 10141.ENSCPOP00000003314 XP_005006347.1.53824 ENSCPOP00000003314 ENSCPOP00000003314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]