SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003379 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003379
Domain Number 1 Region: 119-357
Classification Level Classification E-value
Superfamily Radical SAM enzymes 8.63e-26
Family Oxygen-independent coproporphyrinogen III oxidase HemN 0.045
Further Details:      
 
Domain Number 2 Region: 353-541
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000063
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003379   Gene: ENSCPOG00000003742   Transcript: ENSCPOT00000003786
Sequence length 546
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:63909401:63981010:1 gene:ENSCPOG00000003742 transcript:ENSCPOT00000003786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDI
IAAVPPQYRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLKDSGFKVVAHMMPDLPNVGLERDIEQF
VEFFENPAFRPDGMKLYPTLVIRGTGLYELWKSGRYKSYSPSDLIELVARILALVPPWTR
VYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVE
LVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGSV
VPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGPY
MVKMLR
Download sequence
Identical sequences ENSCPOP00000003379 10141.ENSCPOP00000003379 ENSCPOP00000003379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]