SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003457 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003457
Domain Number 1 Region: 40-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000171
Family V set domains (antibody variable domain-like) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003457   Gene: ENSCPOG00000003831   Transcript: ENSCPOT00000003875
Sequence length 154
Comment pep:known_by_projection scaffold:cavPor3:scaffold_19:29900441:29909249:1 gene:ENSCPOG00000003831 transcript:ENSCPOT00000003875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRTRDRGKALARWLGTGLLGLLLLPVSLSLEVSVGKATTIYAVNGTEILLPCTFSSCFG
FEDLRFWWSYNSSDTSRILIDGTVKNEKSDPKLKLKDDDRITLVGTTKEKKNNISILLRD
LEFSDSGKYTCHVRNPKEKDLEHQATIILQVVDK
Download sequence
Identical sequences ENSCPOP00000003457 10141.ENSCPOP00000003457 ENSCPOP00000003457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]