SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Cavia porcellus 76_3 > ENSCPOP00000003461

Domain assignment for ENSCPOP00000003461 from Cavia porcellus 76_3

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSCPOP00000003461
Domain Number 1	Region: 53-90
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000209
Family	LDL receptor-like module	0.00067
Further Details:

Domain Number 2	Region: 132-168
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000524
Family	LDL receptor-like module	0.0011
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSCPOP00000003461 Gene: ENSCPOG00000003835 Transcript: ENSCPOT00000003879
Sequence length	262
Comment	pep:known_by_projection scaffold:cavPor3:scaffold_195:470481:474302:-1 gene:ENSCPOG00000003835 transcript:ENSCPOT00000003879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	ASSGWMACGGPLRSAVLGLGLRLLLGLGLGLEAAPTSASTWLLTPSPGPSIGSCLPPDFQ CRTNGFCIPPTWRCDGDIDCEDGSDEEKCRIQPCAQNGQCPPPADSTCFCDSISDCLGDP DKNLQNCSHRQPCPTNQMPCKTVDMCVPHEWHCDRHPDCPDGSDELGCEVKLKEGHASTV GTPVTLAGVTSLSNATDSFEDQPGNPSSYKVIAAAGLLGVSLTAVTVLVLFQLRAQRSQR PLGLLVAVKDSLMLSERKRSVL
Download sequence
Identical sequences	ENSCPOP00000003461 10141.ENSCPOP00000003461 ENSCPOP00000003461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]