SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003562 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003562
Domain Number 1 Region: 13-92
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000492
Family Snake venom toxins 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003562   Gene: ENSCPOG00000003944   Transcript: ENSCPOT00000003988
Sequence length 116
Comment pep:novel scaffold:cavPor3:scaffold_17:35017409:35018125:1 gene:ENSCPOG00000003944 transcript:ENSCPOT00000003988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALFTLFFVALAGLPLAQALECHVCAYNGDNCFNPMRCPAMVRYCMTTRTYYTPYRMKV
SKSCVPSCFETVYDGYSKHASTTSCCQYDLCNVAGLAVPGALVFAPILLATIWSLI
Download sequence
Identical sequences A0A286XLH9
ENSCPOP00000003562 10141.ENSCPOP00000003562 ENSCPOP00000003562 XP_003473334.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]